PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 197aa    MW: 22351.1 Da    PI: 4.3159
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016895genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1611e-491019484273
         GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                  f +  P   +s+++a qaI+++v++++r+Hi+Df+i++G QW+ ++qaL + +  ++  +l+iT++g     +k++leetg+rL +fA+++ ++f+f+
  Lus10016895  10 FCDKVPSGPVSQFAAIQAIVDSVAKATRIHIVDFNIKHGEQWIIFMQALVEENwkNPVEHLKITAIGT---MRKDMLEETGQRLIDFAQAMALSFSFK 104
                  6666788899****************************************999756666*********...67************************* PP

         GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                  +++++++ dle ++++v+++E++aV   + l ++     s  ++ d+v+kl+++l+P v+vv+e e++ ns+ F++r++e l   sa+f +le+
  Lus10016895 105 MIMVEDFMDLEQDMFEVDSDETVAVLAEYLLTTII----SRVEKVDSVMKLIRGLNPCVMVVTEVESNQNSPVFVNRLVEMLFSASAFFYCLEV 194
                  *****************************999998....44444778*******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.9541196IPR005202Transcription factor GRAS
PfamPF035143.5E-4710194IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MPTRECFLEF CDKVPSGPVS QFAAIQAIVD SVAKATRIHI VDFNIKHGEQ WIIFMQALVE  60
ENWKNPVEHL KITAIGTMRK DMLEETGQRL IDFAQAMALS FSFKMIMVED FMDLEQDMFE  120
VDSDETVAVL AEYLLTTIIS RVEKVDSVMK LIRGLNPCVM VVTEVESNQN SPVFVNRLVE  180
MLFSASAFFY CLEVCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-21619679273GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351161.14e-64PREDICTED: DELLA protein RGL2-like
TrEMBLB9HWZ79e-63B9HWZ7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15350.12e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-30RGA-like 2